PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00007906001
Common NameGSBRNA2T00007906001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 114aa    MW: 12756.3 Da    PI: 9.9161
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00007906001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.4e-393999262
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                         k++al+cprC+s ntkfCyynnysl+qPryfCk C+ryWt+GG+lrn+P+Ggg rknk+ s
  GSBRNA2T00007906001 39 KDHALNCPRCNSLNTKFCYYNNYSLTQPRYFCKDCKRYWTQGGSLRNIPIGGGLRKNKRPS 99
                         67899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-292391IPR003851Zinc finger, Dof-type
PfamPF027013.2E-344197IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.4724397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MDTAKWPQEF IVKPMNETCL KQPNPATAPV EEKKARPEKD HALNCPRCNS LNTKFCYYNN  60
YSLTQPRYFC KDCKRYWTQG GSLRNIPIGG GLRKNKRPSS SSSSSSNSNS SSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0095192e-60AC009519.4 Genomic sequence for Arabidopsis thaliana BAC F1N19 from chromosome I, complete sequence.
GenBankAK2284162e-60AK228416.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-93-K01.
GenBankAY0848982e-60AY084898.1 Arabidopsis thaliana clone 120488 mRNA, complete sequence.
GenBankBT0040472e-60BT004047.1 Arabidopsis thaliana clone RAFL14-91-B14 (R20433) putative Dof zinc finger protein (At1g64620) mRNA, complete cds.
GenBankBT0051482e-60BT005148.1 Arabidopsis thaliana clone U20433 putative Dof zinc finger protein (At1g64620) mRNA, complete cds.
GenBankCP0026842e-60CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013658103.11e-71PREDICTED: LOW QUALITY PROTEIN: dof zinc finger protein DOF1.8, partial
SwissprotQ84JQ84e-53DOF18_ARATH; Dof zinc finger protein DOF1.8
TrEMBLA0A078JWQ91e-79A0A078JWQ9_BRANA; BnaAnng35190D protein
STRINGfgenesh2_kg.2__13__AT1G64620.11e-56(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34332761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64620.14e-53Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]